DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and rpsH

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_417765.1 Gene:rpsH / 947802 ECOCYCID:EG10907 Length:130 Species:Escherichia coli


Alignment Length:137 Identity:39/137 - (28%)
Similarity:64/137 - (46%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHR-------- 57
            |...:.:||.|..|.|.:...|..|.: |.||:.:....|:.:.|:|.:|::..|.:        
E. coli     1 MSMQDPIADMLTRIRNGQAANKAAVTM-PSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLK 64

  Fly    58 --SGKIVVNLTGRLNKCGV-ISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRK 119
              .||.||....|:::.|: |..|.|    ::.|....|      |..|::||.|:|....||:.
E. coli    65 YFQGKAVVESIQRVSRPGLRIYKRKD----ELPKVMAGL------GIAVVSTSKGVMTDRAARQA 119

  Fly   120 HLGGKIL 126
            .|||:|:
E. coli   120 GLGGEII 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 39/137 (28%)
rpsHNP_417765.1 rpsH 2..130 CDD:234658 38/136 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I755
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I485
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto111864
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.