DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and MRPS8

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_013879.1 Gene:MRPS8 / 855190 SGDID:S000004767 Length:155 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:36/139 - (25%)
Similarity:59/139 - (42%) Gaps:39/139 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LRPCSKVIIK---------------------FLTVMMKHGYIG---EF-EIVDDHRS-GKIVVNL 65
            |:.||||.:.                     ||:.:.|...:|   :| |:..|:.| .::.|.|
Yeast    13 LQNCSKVRVALTSIPYTKLQLQFAYNLYQQGFLSSLQKGSTMGPDKDFVEVTPDNISTRRLWVGL 77

  Fly    66 TGRLNK-----CGVIS---PRFDVPINDIEKWTN-----NLLPSRQFGYVVLTTSGGIMDHEEAR 117
            ..|.||     |.:||   .|..:|:.|::|..:     |:.|.:....:::.....|||..||.
Yeast    78 KYRDNKPVLSSCKLISKPNSRIHLPMEDMKKLCSGVTIRNIKPLQPGELILVRAHNNIMDINEAI 142

  Fly   118 RKHLGGKIL 126
            .|.|.|::|
Yeast   143 SKKLDGEVL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 36/139 (26%)
MRPS8NP_013879.1 Ribosomal_S8 6..154 CDD:412314 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100322
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.