DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and RPS22A

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_012345.1 Gene:RPS22A / 853249 SGDID:S000003726 Length:130 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:105/130 - (80%)
Similarity:113/130 - (86%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNL 65
            |.|.:||||||..||||||.||||||:||.||||||||.||.|||||||||.:||||||||||.|
Yeast     1 MTRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQL 65

  Fly    66 TGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            .|||||||||||||:|.|.||||||.||||:||||||:||||.||||||||||||:.||||||.:
Yeast    66 NGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGKILGFVY 130

  Fly   131  130
            Yeast   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 105/128 (82%)
RPS22ANP_012345.1 PTZ00158 1..130 CDD:185487 105/128 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345383
Domainoid 1 1.000 211 1.000 Domainoid score I499
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 217 1.000 Inparanoid score I781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62199
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - mtm9244
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - LDO PTHR11758
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2269
SonicParanoid 1 1.000 - - X687
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.