DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and rps15ab

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_179562.1 Gene:rps15ab / 816491 AraportID:AT2G19720 Length:129 Species:Arabidopsis thaliana


Alignment Length:124 Identity:63/124 - (50%)
Similarity:90/124 - (72%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNLTGRLN 70
            :|.|||:.|.|||||||..|.|:|.|.|:..||.:|.:.|||..|::.|.||.|:|.|:|.||:|
plant     5 ILNDALRTIVNAEKRGKASVELKPVSTVMSSFLKIMKEKGYIKNFQVHDPHRVGRITVDLQGRVN 69

  Fly    71 KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFF 129
            .|..::.|.||..|:|.::|...||:||:||:|:||..||:|||||.::::||::||||
plant    70 DCKALTYRQDVKANEIGQYTERTLPTRQWGYIVITTPDGILDHEEAIKRNVGGQVLGFF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 63/124 (51%)
rps15abNP_179562.1 PLN00146 1..129 CDD:215075 63/124 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62199
OrthoDB 1 1.010 - - D1417658at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.