DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and RpS15Ab

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster


Alignment Length:130 Identity:127/130 - (97%)
Similarity:129/130 - (99%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||:|||||||
  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            |||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130

  Fly   131  130
              Fly   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 125/128 (98%)
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 125/128 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462304
Domainoid 1 1.000 205 1.000 Domainoid score I829
eggNOG 1 0.900 - - E1_COG0096
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 213 1.000 Inparanoid score I1241
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62199
OrthoDB 1 1.010 - - D115954at33392
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - otm26585
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - P PTHR11758
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2269
SonicParanoid 1 1.000 - - X687
1413.840

Return to query results.
Submit another query.