DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and mrps8

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_587781.1 Gene:mrps8 / 2539594 PomBaseID:SPCC736.10c Length:152 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:25/149 - (16%)
Similarity:50/149 - (33%) Gaps:57/149 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHR-------------------------SG 59
            |.::.:...|....:::...|:...|::...:..|.|.                         .|
pombe    15 RARKSLASVPNCNSVLELCAVLYHQGFLSSIQRGDIHGPDALPTITTRQNVATRRLWLGLKYFEG 79

  Fly    60 KIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPS--------RQFGYV---------VLTTS 107
            |.|::....::|          |...:     ||.||        |:..:|         ::.|.
pombe    80 KPVLHYIRAVSK----------PSRKV-----NLTPSELLQFAKGRKVSFVNGLEPAEVGIVETK 129

  Fly   108 GGIMDHEEARRKHLGGKIL 126
            .|||..::|.:.:|||.::
pombe   130 HGIMSIDDAIKNNLGGNVI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 25/149 (17%)
mrps8NP_587781.1 Ribosomal_S8 6..151 CDD:278821 25/149 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100322
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.