DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and LOC100364191

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_038967324.1 Gene:LOC100364191 / 100364191 RGDID:2321567 Length:130 Species:Rattus norvegicus


Alignment Length:130 Identity:109/130 - (83%)
Similarity:119/130 - (91%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNL 65
            ||||||||||||.|||||||||||||:|||.|||::||||||||||||||:.:.|||:|||||||
  Rat     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCFKVIVRFLTVMMKHGYIGEFKFIGDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            ||||||||||||||||.:.|:|||.||||||.|||::|||||.||||.|||||||.|||||||||
  Rat    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSWQFGFIVLTTSAGIMDQEEARRKHTGGKILGFFF 130

  Fly   131  130
              Rat   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 107/128 (84%)
LOC100364191XP_038967324.1 PTZ00158 1..130 CDD:185487 107/128 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11758
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.