DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Aa and rps15a

DIOPT Version :9

Sequence 1:NP_001162738.1 Gene:RpS15Aa / 44150 FlyBaseID:FBgn0010198 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001096489.1 Gene:rps15a / 100125111 XenbaseID:XB-GENE-981311 Length:130 Species:Xenopus tropicalis


Alignment Length:130 Identity:116/130 - (89%)
Similarity:124/130 - (95%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGKIVVNL 65
            ||||||||||||.|||||||||||||:|||||||::||||||||||||||||:||||:|||||||
 Frog     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            ||||||||||||||||.:.|:|||.|||||||||||:|||||.||||||||||||.|||||||||
 Frog    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGYIVLTTSAGIMDHEEARRKHTGGKILGFFF 130

  Fly   131  130
             Frog   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AaNP_001162738.1 PTZ00158 1..130 CDD:185487 114/128 (89%)
rps15aNP_001096489.1 PTZ00158 1..130 CDD:185487 114/128 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 233 1.000 Domainoid score I2347
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 245 1.000 Inparanoid score I3207
OMA 1 1.010 - - QHG62199
OrthoDB 1 1.010 - - D1417658at2759
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - otm48855
Panther 1 1.100 - - LDO PTHR11758
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X687
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.