DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and CanA-14F

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:296 Identity:118/296 - (39%)
Similarity:176/296 - (59%) Gaps:24/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGD 107
            |.:.|:....|.|....|..::..::::.|||.:|||:||||.||:::|:..|.|..:.||||||
  Fly   128 GRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGD 192

  Fly   108 YVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYD 172
            |||||:.|||.:..|.:.|:.||:|.||||||||...|...:.|..|||.:||.:::.:.:|.:|
  Fly   193 YVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFD 257

  Fly   173 CMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASND-- 235
            |:|:||::..:..||||||||:::.|:|||||:|..:.|:.|.:||||||||.|..|...::|  
  Fly   258 CLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFY 322

  Fly   236 -----RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQ------LVTIFSAPNYCD 289
                 ||.|:.:.......||..:....|:|||:..:.||..:...|      |:||||||||.|
  Fly   323 THNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD 387

  Fly   290 IFDNCGAVLVVDAKLV------CHFVIIRPRPFSRP 319
            :::|..|||..:..::      |     .|.|:..|
  Fly   388 VYNNKAAVLKYENNVMNIRQFNC-----SPHPYWLP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 118/296 (40%)
MPP_superfamily 25..313 CDD:301300 115/288 (40%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 118/296 (40%)
PP2Ac 132..403 CDD:197547 113/270 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.