DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and PPN2

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_014182.1 Gene:PPN2 / 855504 SGDID:S000005161 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:50/271 - (18%)
Similarity:84/271 - (30%) Gaps:104/271 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RRAGNLSEATITYI--CQASRELF------LSQPMLL--------------ELSAPVKICGDLHG 82
            |||..||.|.|.::  |..:..:|      ||.|:.|              :|:......||:||
Yeast     7 RRAATLSTALILFVACCVYTLYIFKFDNPRLSPPVSLLPTISTLKKIEHVTDLNKEYVFVGDVHG 71

  Fly    83 QFKDLLRIFQQ--CGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHE---- 141
            .:.:.:.:...  .|:......:.|||::.:|..|.:.:|.:|.:|    :....:.||||    
Yeast    72 NYDEFIELIDDKIGGLGENITMILLGDFIHKGPDSDKVVSYILNHK----DQVKCVLGNHEILVM 132

  Fly   142 -----------------------SADLN-----------------RVYGF------FDECKRRYS 160
                                   |.:.|                 |..||      .:.|.....
Yeast   133 MAYLNPDFSKWVRRPKLMTPLTFSTETNFIPQDISKISNAHGRLARELGFSKLSQLAEHCSMAIE 197

  Fly   161 IKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPD 225
            :.|              .|..|.:|..|.|:.|.        ...:|..:|....|.::.:.|..
Yeast   198 LDL--------------DITGDILFGAHAGMVPG--------DFMKPNQIPGVSSLSNMKYVDKK 240

  Fly   226 ETTGTWASNDR 236
                .|:...|
Yeast   241 ----NWSKTSR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 50/271 (18%)
MPP_superfamily 25..313 CDD:301300 50/271 (18%)
PPN2NP_014182.1 MPP_PPP_family 64..307 CDD:277316 36/214 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104510
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.