DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and CMP2

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_013655.1 Gene:CMP2 / 854946 SGDID:S000004521 Length:604 Species:Saccharomyces cerevisiae


Alignment Length:392 Identity:132/392 - (33%)
Similarity:197/392 - (50%) Gaps:78/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRRSTVL---STGKESSKE------------EKNR--MSQLDVIIGQLKT--------------- 34
            |:.|||.   ||..|:|::            ..||  |:::..|...:.|               
Yeast    35 SKASTVAAANSTATETSRDLTQYTLDDGRVVSTNRRIMNKVPAITSHVPTDEELFQPNGIPRHEF 99

  Fly    35 MAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPL 99
            :....:|.|.||.|....|...:.|||..:|.|:.:.||:.:|||:|||:.|||::|:..|.|..
Yeast   100 LRDHFKREGKLSAAQAARIVTLATELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPAT 164

  Fly   100 SNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLW 164
            ::|||||||||||..|.|.|..|.:.||.:.:.|:|||||||...|...:.|.:|...:|::.::
Yeast   165 TSYLFLGDYVDRGSFSFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIY 229

  Fly   165 RSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDP----D 225
            ....:.::.:|:||::..:..|||||:||:||:|.||..|||..::||.||:|||||:||    |
Yeast   230 EKCCESFNNLPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYD 294

  Fly   226 ETT-------------------GTWA-SND-------RGVSFTFGANIVEGFLMQHKFNLIVRAH 263
            |..                   |..| |.|       ||.|:.|.......||.:.....|:|||
Yeast   295 EVLDKDLTEEDIVNSKTMVPHHGKMAPSRDMFVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAH 359

  Fly   264 QVVEDGYEFFADRQ------LVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIR-----PRPFS 317
            :..:.||..:.:.:      |:|:||||||.|.::|..|:|    |...:.:.||     |.|:.
Yeast   360 EAQDAGYRMYKNTKTLGFPSLLTLFSAPNYLDTYNNKAAIL----KYENNVMNIRQFNMTPHPYW 420

  Fly   318 RP 319
            .|
Yeast   421 LP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 124/360 (34%)
MPP_superfamily 25..313 CDD:301300 118/344 (34%)
CMP2NP_013655.1 MPP_PP2B 95..423 CDD:277361 119/332 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.