DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and PPH21

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:132/300 - (44%)
Similarity:191/300 - (63%) Gaps:11/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STVLSTGKESSKEEKN--RMSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPML 67
            |:.::..|.|...|.|  .::|||..|..|.       :...|||..:..:|:.:.::...:..:
Yeast    48 SSGIADHKSSKPLELNNTNINQLDQWIEHLS-------KCEPLSEDDVARLCKMAVDVLQFEENV 105

  Fly    68 LELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPET 132
            ..::.||.||||:||||.|||.:|:..|..|.:||||:|||||||:.|:||:|.|:..|:|||..
Yeast   106 KPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHR 170

  Fly   133 FFLLRGNHESADLNRVYGFFDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLN 196
            ..:|||||||..:.:||||:|||.|:| |..:|:.|.|.:|..|:.|::.::|||:||||||.:.
Yeast   171 ITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIE 235

  Fly   197 NLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVR 261
            .:|.:|.|||..:||.:|.:|||||||||: .|.|..:.||..||||.::.|.|...:..:||.|
Yeast   236 TIDQVRELNRIQEVPHEGPMCDLLWSDPDD-RGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIAR 299

  Fly   262 AHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVD 301
            |||:|.:||.:...:.:||||||||||....|..|::.||
Yeast   300 AHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVD 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 127/285 (45%)
MPP_superfamily 25..313 CDD:301300 125/277 (45%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 125/277 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.