DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and CNA1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_013537.1 Gene:CNA1 / 851153 SGDID:S000004425 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:110/301 - (36%)
Similarity:168/301 - (55%) Gaps:27/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGD 107
            |.||:.....|...|......:|.||:|.||:.||||:|||:.|||::|:..|.|...:||||||
Yeast    83 GRLSKEQAIKILNMSTVALSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGD 147

  Fly   108 YVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYD 172
            |||||..|.|.|..|.:.||.....|::||||||...|...:.|.:|...:|.::::.:....::
Yeast   148 YVDRGAFSFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFN 212

  Fly   173 CMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDP------------- 224
            .:|:||::..:.||||||:||:|.:::|:.::||..::||.||:|||||:||             
Yeast   213 VLPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEF 277

  Fly   225 DETTGTWASND-RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQ------LVTIF 282
            |::...:..|. ||.||.|.......||..:....|:|||:..:.||..:.:.:      |:|:|
Yeast   278 DQSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITMF 342

  Fly   283 SAPNYCDIFDNCGAVLVVDAKLV----CHFVIIRPRPFSRP 319
            |||||.|.:.|..|||..:..::    .|   :.|.|:..|
Yeast   343 SAPNYLDTYHNKAAVLKYEENVMNIRQFH---MSPHPYWLP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 110/301 (37%)
MPP_superfamily 25..313 CDD:301300 107/293 (37%)
CNA1NP_013537.1 MPP_PP2B 70..381 CDD:277361 110/301 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.