DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and AT1G48120

DIOPT Version :10

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_175246.2 Gene:AT1G48120 / 841230 AraportID:AT1G48120 Length:1340 Species:Arabidopsis thaliana


Alignment Length:275 Identity:82/275 - (29%)
Similarity:132/275 - (48%) Gaps:61/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 APVKICGDLHGQFKDLLRIFQQCGVPPLSN-YLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFL 135
            |.|.:.||||||..|||.:.|..|.|.... |:|.|:|||.|...:||..|||::|:..|...:|
plant   653 AEVVVVGDLHGQLHDLLYLMQDAGFPDGDRFYVFNGNYVDIGAWGLETFLLLLSWKVLLPARVYL 717

  Fly   136 LRGNHESADLNRVYGFFDECKRRYSIK---LWRSFVDCYDCMPVAAIIADRIFCVHGGLSPD--- 194
            |||:|||.....:|||.:|...:|..|   :::..::|:..:|:|::||.:::..||||..|   
plant   718 LRGSHESESCTSMYGFKNEVLTKYGDKGAAVYKKCLECFQLLPLASVIAGKVYTAHGGLFRDVSS 782

  Fly   195 -----------------------------------LNNLDDIRRLNRPT-DVPSDG---LLCDLL 220
                                               |.:|.|:.::.|.. |.|::|   :..|:|
plant   783 FLSDKQERNRKRKRTQKKQTDNTVLDTEDRSESLPLGSLKDLSKVKRRVIDPPTEGSNLIPGDIL 847

  Fly   221 WSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVED------------GYEFF 273
            ||||.:.||.:.:.:||:...:|.:....||..:....|:|.....::            ||.  
plant   848 WSDPSKDTGLFLNKERGIGLLWGPDCTAKFLQDNNLKWIIRGKGAPDERAKRDDLAPMNGGYA-- 910

  Fly   274 ADRQ-LVTIFSAPNY 287
            .|.: |:|:||||::
plant   911 EDHEGLITLFSAPDH 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 MPP_superfamily 25..313 CDD:472684 82/275 (30%)
AT1G48120NP_175246.2 PMD 68..435 CDD:463139
MPP_PP7 589..971 CDD:163661 82/275 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.