DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and TOPP2

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001032103.1 Gene:TOPP2 / 836034 AraportID:AT5G59160 Length:312 Species:Arabidopsis thaliana


Alignment Length:292 Identity:180/292 - (61%)
Similarity:227/292 - (77%) Gaps:4/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQL---KTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            ||.||.:|   :....|.::| .|:|:.|..:|..|||:||.||.||||.||:|||||:|||:.|
plant    14 LDDIIRRLLDYRNPKPGTKQA-MLNESEIRQLCIVSREIFLQQPNLLELEAPIKICGDIHGQYSD 77

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |||:|:..|.||.:||||||||||||..|:||:.|||.||::|||.|||||||||.|.:||:|||
plant    78 LLRLFEYGGFPPTANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 142

  Fly   152 FDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLL 216
            :||||||:|::||:.|.|.::|:||||:|.|:|.|:||||||||.|::.|:.:.||||||..|||
plant   143 YDECKRRFSVRLWKVFTDSFNCLPVAAVIDDKILCMHGGLSPDLTNVEQIKNIKRPTDVPDSGLL 207

  Fly   217 CDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTI 281
            ||||||||.:....|..||||||:|||.:.|..||:::..:||.|||||||||||||||||||||
plant   208 CDLLWSDPSKDVKGWGMNDRGVSYTFGPDKVAEFLIKNDMDLICRAHQVVEDGYEFFADRQLVTI 272

  Fly   282 FSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313
            |||||||..|||.||::.||..|:|.|.|::|
plant   273 FSAPNYCGEFDNAGAMMSVDESLMCSFQILKP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 180/292 (62%)
MPP_superfamily 25..313 CDD:301300 179/290 (62%)
TOPP2NP_001032103.1 MPP_PP1_PPKL 14..304 CDD:277359 179/290 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.