DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and TOPP6

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_851123.1 Gene:TOPP6 / 834356 AraportID:AT5G43380 Length:331 Species:Arabidopsis thaliana


Alignment Length:297 Identity:181/297 - (60%)
Similarity:226/297 - (76%) Gaps:3/297 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYV 109
            |||..|..:|..||::||.||.||||.||||||||:|||:.||||:|:..|.||.||||||||||
plant    26 LSETEIKQLCFVSRDIFLRQPNLLELEAPVKICGDIHGQYPDLLRLFEHGGYPPNSNYLFLGDYV 90

  Fly   110 DRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCM 174
            |||..|:||:.|||.||:::||.|||||||||||.:||:|||:||||||:|:|:||.|.||::|:
plant    91 DRGKQSLETICLLLAYKIKFPENFFLLRGNHESASINRIYGFYDECKRRFSVKIWRIFTDCFNCL 155

  Fly   175 PVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVS 239
            ||||:|.:||||:||||||:|.:|..||.:.||||:|..||||||||||||:....|..||||||
plant   156 PVAALIDERIFCMHGGLSPELLSLRQIRDIRRPTDIPDRGLLCDLLWSDPDKDVRGWGPNDRGVS 220

  Fly   240 FTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKL 304
            :|||::||.|||.:...:||.|||||||||:||||::||||||||||||..|||.||::.|...|
plant   221 YTFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQLVTIFSAPNYCGEFDNAGAMMSVSEDL 285

  Fly   305 VCHFVIIRPRPFSRPTGFESDSGSTATATNGPPPSMR 341
            .|.|.|::.........|.|..|:   .|:.|.|.::
plant   286 TCSFQILKSNDKKSKFSFGSRGGA---KTSFPYPKVK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 180/293 (61%)
MPP_superfamily 25..313 CDD:301300 175/267 (66%)
TOPP6NP_851123.1 PTZ00480 6..297 CDD:185658 175/270 (65%)
MPP_PP1_PPKL 6..293 CDD:277359 175/266 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.