DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and TOPP5

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_190266.1 Gene:TOPP5 / 823835 AraportID:AT3G46820 Length:312 Species:Arabidopsis thaliana


Alignment Length:293 Identity:178/293 - (60%)
Similarity:229/293 - (78%) Gaps:6/293 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGNRRAGN----LSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFK 85
            ||.||.:|  :...|.:||.    |:::.|..:|..|||:||.||.||||:||||||||:|||:.
plant    14 LDDIIRRL--LDYRNPKAGTKQAMLNDSEIRQLCFVSREIFLQQPCLLELAAPVKICGDIHGQYS 76

  Fly    86 DLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYG 150
            ||||:|:..|.||.:||||||||||||..|:||:.|||.||::|||.|||||||||.|.:||:||
plant    77 DLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYG 141

  Fly   151 FFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGL 215
            |:||||||:::|||:.|.|.::|:||||:|.::|.|:||||||:|.|::.|:.:.||||||..||
plant   142 FYDECKRRFNVKLWKVFTDTFNCLPVAAVIDEKILCMHGGLSPELINVEQIKNIERPTDVPDAGL 206

  Fly   216 LCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVT 280
            |||||||||.:....|..||||||:||||:.|..||:::..:|:.||||||||||||||||||||
plant   207 LCDLLWSDPSKDVKGWGMNDRGVSYTFGADKVAEFLIKNDMDLVCRAHQVVEDGYEFFADRQLVT 271

  Fly   281 IFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313
            :|||||||..|||.||::.||..|:|.|.|::|
plant   272 MFSAPNYCGEFDNAGALMSVDESLMCSFQILKP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 178/293 (61%)
MPP_superfamily 25..313 CDD:301300 177/291 (61%)
TOPP5NP_190266.1 MPP_PP1_PPKL 13..304 CDD:277359 177/291 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.