DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and AT3G09970

DIOPT Version :10

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_566364.1 Gene:AT3G09970 / 820158 AraportID:AT3G09970 Length:309 Species:Arabidopsis thaliana


Alignment Length:77 Identity:27/77 - (35%)
Similarity:42/77 - (54%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IC-GDLHGQFKDL--LRIFQQCGVPPLSNY-----LFLGDYVDRGHCSIETLSLLLTYKLRYP-E 131
            || ||:||....|  |.:..|..:.| |::     :|||||.|||..:.:.:..|::...::| :
plant     9 ICVGDIHGYISKLNNLWLNLQSAIDP-SDFSSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQ 72

  Fly   132 TFFLLRGNHESA 143
            |...|.|||:.|
plant    73 THVFLAGNHDFA 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 MPP_superfamily 25..313 CDD:472684 27/77 (35%)
AT3G09970NP_566364.1 MPP_Rhilphs 5..308 CDD:163664 27/77 (35%)

Return to query results.
Submit another query.