DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and AT3G09960

DIOPT Version :10

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_566363.1 Gene:AT3G09960 / 820157 AraportID:AT3G09960 Length:311 Species:Arabidopsis thaliana


Alignment Length:106 Identity:30/106 - (28%)
Similarity:46/106 - (43%) Gaps:26/106 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IC-GDLHGQFKDLLRIFQQCGVPPLSN-------YLFLGDYVDRGHCSIETLSLLLTYKLRYP-E 131
            || ||:||....|.:::... ...:.|       .:|||||.|||..:.:.:..|::...::| :
plant    10 ICVGDIHGNISKLNKLWLNL-QSDIQNSDFSSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQ 73

  Fly   132 TFFLLRGNHESADLNRVYGF------------FDECKRRYS 160
            |...|.|||:.|    ..||            |.|..:.||
plant    74 THVFLAGNHDFA----FAGFLGLLPRPSDGSEFKETWKEYS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 MPP_superfamily 25..313 CDD:472684 30/106 (28%)
AT3G09960NP_566363.1 MPP_Rhilphs 6..310 CDD:163664 30/106 (28%)

Return to query results.
Submit another query.