DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and TOPP9

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_187209.1 Gene:TOPP9 / 819724 AraportID:AT3G05580 Length:318 Species:Arabidopsis thaliana


Alignment Length:304 Identity:178/304 - (58%)
Similarity:229/304 - (75%) Gaps:2/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SSKEEKNRMSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICG 78
            :|.|....|..||.||.:| ....|.::. .|||..|..:|..:|::|||||.||||.||::|||
plant     3 TSMEGMMEMGVLDDIIRRL-LEGKGGKQV-QLSEVEIRQLCVNARQIFLSQPNLLELHAPIRICG 65

  Fly    79 DLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESA 143
            |:|||::||||:|:..|.||.:||||||||||||..|:||:.|||.||:|||...||||||||.|
plant    66 DIHGQYQDLLRLFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKIFLLRGNHEDA 130

  Fly   144 DLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPT 208
            .:||:|||:||||||::::||:.|.||::|:||||:|.::|.|:||||||:|.||..||.:.|||
plant   131 KINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDEKILCMHGGLSPELENLGQIREIQRPT 195

  Fly   209 DVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFF 273
            ::|.:||||||||||||:....|..:|||:|.||||::|..||.::..:||.|.|||||||||||
plant   196 EIPDNGLLCDLLWSDPDQKNEGWTDSDRGISCTFGADVVADFLDKNDLDLICRGHQVVEDGYEFF 260

  Fly   274 ADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRPFS 317
            |.|:||||||||||...|||.||:|.||..|||.|.|::|.|.|
plant   261 AKRRLVTIFSAPNYGGEFDNAGALLSVDQSLVCSFEILKPAPAS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 176/299 (59%)
MPP_superfamily 25..313 CDD:301300 172/287 (60%)
TOPP9NP_187209.1 MPP_PP1_PPKL 13..300 CDD:277359 172/288 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.