DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and TOPP4

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_181514.1 Gene:TOPP4 / 818571 AraportID:AT2G39840 Length:321 Species:Arabidopsis thaliana


Alignment Length:312 Identity:180/312 - (57%)
Similarity:236/312 - (75%) Gaps:9/312 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STVLSTGKESSKEEKNRMSQLDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPM 66
            :|..:.|::::.:.    :.||.||.:|..:.:.  |.|   .||||.|..:|..:|::||.||.
plant     3 TTTTTQGQQTAIDS----AVLDDIIRRLTEVRLA--RPGKQVQLSEAEIKQLCTTARDIFLQQPN 61

  Fly    67 LLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPE 131
            ||||.||:|||||:|||:.||||:|:..|.||.:||||||||||||..|:||:.|||.||::||.
plant    62 LLELEAPIKICGDIHGQYSDLLRLFEYGGFPPSANYLFLGDYVDRGKQSLETICLLLAYKIKYPG 126

  Fly   132 TFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLN 196
            .|||||||||.|.:||:|||:||||||:::::|:.|.||::|:||||:|.|:|.|:||||||||:
plant   127 NFFLLRGNHECASINRIYGFYDECKRRFNVRVWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLD 191

  Fly   197 NLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVR 261
            :||:||.|.|||.:|..|||||||||||.:....|..||||||:|||.:.|..||.:|..:|:.|
plant   192 HLDEIRNLPRPTMIPDTGLLCDLLWSDPGKDVKGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCR 256

  Fly   262 AHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313
            |||||||||||||||||||:|||||||..|||.||::.||..|:|.|.|::|
plant   257 AHQVVEDGYEFFADRQLVTVFSAPNYCGEFDNAGAMMSVDENLMCSFQILKP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 178/298 (60%)
MPP_superfamily 25..313 CDD:301300 177/290 (61%)
TOPP4NP_181514.1 MPP_PP1_PPKL 18..308 CDD:277359 177/291 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.