DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and ppp3ca

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001185479.1 Gene:ppp3ca / 794574 ZFINID:ZDB-GENE-091113-24 Length:521 Species:Danio rerio


Alignment Length:298 Identity:118/298 - (39%)
Similarity:173/298 - (58%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFL 105
            :.|.:.|.....|......:...:..:|::.|||.:|||:||||.||:::|:..|.|..:.||||
Zfish    51 KEGRVEETVALRIINEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFL 115

  Fly   106 GDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDC 170
            |||||||:.|||.:..|.:.|:.||:|.||||||||...|...:.|..|||.:||.:::.|.:|.
Zfish   116 GDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDA 180

  Fly   171 YDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASND 235
            :||:|:||::..:..||||||||::..||||::|:|..:.|:.|.:||||||||.|..|...|.:
Zfish   181 FDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQE 245

  Fly   236 -------RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQ------LVTIFSAPNY 287
                   ||.|:.:....|..||..:....|:|||:..:.||..:...|      |:||||||||
Zfish   246 YFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNY 310

  Fly   288 CDIFDNCGAVLVVDAKLV------CHFVIIRPRPFSRP 319
            .|:::|..|||..:..::      |     .|.|:..|
Zfish   311 LDVYNNKAAVLKYENNVMNIRQFNC-----SPHPYWLP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 118/298 (40%)
MPP_superfamily 25..313 CDD:301300 115/290 (40%)
ppp3caNP_001185479.1 MPP_PP2B 40..344 CDD:277361 118/298 (40%)
PP2Ac 59..328 CDD:197547 112/268 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.