DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Ppp5c

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_006228527.2 Gene:Ppp5c / 65179 RGDID:68415 Length:594 Species:Rattus norvegicus


Alignment Length:293 Identity:112/293 - (38%)
Similarity:165/293 - (56%) Gaps:19/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ATITYICQASRELFLSQPMLLELSAP-------------VKICGDLHGQFKDLLRIFQQCGVPPL 99
            |.|..:|.....|....|:...||.|             :.:|||.||||.|||.||:..|:|..
  Rat   293 AWIFLVCCDLSPLIPLCPLPTSLSGPLPLRWPLFFQTEKITVCGDTHGQFYDLLNIFELNGLPSE 357

  Fly   100 SN-YLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKL 163
            :| |:|.||:||||..|:|.:..|..:||.||:.|.|||||||:.::|::|||..|.|.:|:.::
  Rat   358 TNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQM 422

  Fly   164 WRSFVDCYDCMPVAAIIADRIFCVHGGL-SPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDET 227
            :..|.:.::.:|:|..|..::..:|||| |.|...|||||::.|....|..|.:||||||||...
  Rat   423 YELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQ 487

  Fly   228 TGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFD 292
            .|...|. ||||..||.::.:.||.:::.:.|:|:|:|..:|||.....:.||:||||||||...
  Rat   488 NGRSVSK-RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMG 551

  Fly   293 NCGAVLVV---DAKLVCHFVIIRPRPFSRPTGF 322
            |..:.:.:   |.:...|.....|.|..:|..:
  Rat   552 NKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAY 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 112/293 (38%)
MPP_superfamily 25..313 CDD:301300 109/282 (39%)
Ppp5cXP_006228527.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.