DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:290 Identity:171/290 - (58%)
Similarity:217/290 - (74%) Gaps:2/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLR 89
            ||.:|..|.:..:..:..  :.|:.|..:.:.:|::.:|:||||.:.|||.:.||:|||:.||||
  Fly    17 LDEMIASLLSWKIDRKMM--VPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLR 79

  Fly    90 IFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDE 154
            .|:..|.||...||.||||||||..|:|||:|||.||:|||.:..|||||||||.:||.|||:||
  Fly    80 YFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDE 144

  Fly   155 CKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDL 219
            ||||::|:|||.|||||||:||||||..:|||.||||||.|:||:||:.|.||.:|..:||||||
  Fly   145 CKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDL 209

  Fly   220 LWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSA 284
            ||||||.|...|..|.||||||||.:|||.||.:..|:||.||||||||||||||.|||:|:|||
  Fly   210 LWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSA 274

  Fly   285 PNYCDIFDNCGAVLVVDAKLVCHFVIIRPR 314
            .|||..|||.||::.|||:|....|:::|:
  Fly   275 VNYCGEFDNAGAMMCVDAELNITLVVMKPK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 171/290 (59%)
MPP_superfamily 25..313 CDD:301300 170/287 (59%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 170/287 (59%)
PP2Ac 36..305 CDD:197547 167/269 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.