DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and PPP5C

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_016882424.1 Gene:PPP5C / 5536 HGNCID:9322 Length:551 Species:Homo sapiens


Alignment Length:307 Identity:114/307 - (37%)
Similarity:171/307 - (55%) Gaps:33/307 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSN-YLFLGDYVDRGHCSIETLSLLLTYKLRYPE 131
            |:.:..:.:|||.||||.|||.||:..|:|..:| |:|.||:||||..|:|.:..|..:||.||:
Human   231 LKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPD 295

  Fly   132 TFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGL-SPDL 195
            .|.|||||||:.::|::|||..|.|.:|:.:::..|.:.::.:|:|..|..::..:|||| |.|.
Human   296 HFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG 360

  Fly   196 NNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIV 260
            ..|||||::.|....|..|.:||||||||....|...|. ||||..||.::.:.||.::..:.|:
Human   361 VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISK-RGVSCQFGPDVTKAFLEENNLDYII 424

  Fly   261 RAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAK-----------LVCHFVIIRPR 314
            |:|:|..:|||.....:.||:||||||||...|..:.:.:...           :|.|.....|.
Human   425 RSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVVSHPSGPLPL 489

  Fly   315 PFSRPTGFESDS--------------GSTATATN----GPPPSMREK 343
            | |||...|:::              ||..|:.:    ||..|.:.:
Human   490 P-SRPGDKEAETLVRGRGRFCRWVLRGSVLTSVHPTCPGPTASSQRQ 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 113/301 (38%)
MPP_superfamily 25..313 CDD:301300 102/257 (40%)
PPP5CXP_016882424.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.