DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and PPP4C

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001290432.1 Gene:PPP4C / 5531 HGNCID:9319 Length:307 Species:Homo sapiens


Alignment Length:295 Identity:129/295 - (43%)
Similarity:191/295 - (64%) Gaps:9/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.||..|.||       ||...:.|:.:..:|..:||:.:.:..:..:.:||.:|||:||||.|
Human     4 ISDLDRQIEQL-------RRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYD 61

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |..:|:..|..|.:||||:||:||||..|:||..|||..|:|||:...|:||||||..:.:||||
Human    62 LKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGF 126

  Fly   152 FDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGL 215
            :|||.|:| |:.:||...:.:|.:.::|||..:||||||||||.:..||.||.::|..:||.||.
Human   127 YDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGP 191

  Fly   216 LCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVT 280
            :||||||||::||| |..:.||..:.||:::|..|...:..::|.||||:|.:||::..:..::|
Human   192 MCDLLWSDPEDTTG-WGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLT 255

  Fly   281 IFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRP 315
            ::||||||....|..|:|.:|..|...|:|....|
Human   256 VWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 129/295 (44%)
MPP_superfamily 25..313 CDD:301300 127/288 (44%)
PPP4CNP_001290432.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 127/291 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.