DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and PPP1CB

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_002700.1 Gene:PPP1CB / 5500 HGNCID:9282 Length:327 Species:Homo sapiens


Alignment Length:319 Identity:188/319 - (58%)
Similarity:239/319 - (74%) Gaps:8/319 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.:|.:|  :.|...|.|   .::||.:..:|..|||:|||||:||||.||:|||||:|||:.|
Human     8 VDSLITRL--LEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD 70

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |||:|:..|.||.:||||||||||||..|:||:.|||.||::|||.|||||||||.|.:||:|||
Human    71 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 135

  Fly   152 FDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLL 216
            :||||||::||||::|.||::|:|:|||:.::|||.||||||||.:::.|||:.||||||..|||
Human   136 YDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 200

  Fly   217 CDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTI 281
            |||||||||:....|..|||||||||||::|..||.:|..:||.||||||||||||||.|||||:
Human   201 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 265

  Fly   282 FSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP---RPFSRPTGFESDSGSTATATNGPP 337
            |||||||..|||.|.::.||..|:|.|.|::|   :...:..|..|....|...|..||
Human   266 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 188/319 (59%)
MPP_superfamily 25..313 CDD:301300 181/290 (62%)
PPP1CBNP_002700.1 MPP_PP1_PPKL 7..297 CDD:277359 181/290 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.