DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and PPP1CA

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens


Alignment Length:312 Identity:192/312 - (61%)
Similarity:235/312 - (75%) Gaps:16/312 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SSKEEKNRMSQLDVIIGQLK----------TMAVGNRRAGN--LSEATITYICQASRELFLSQPM 66
            |..|:.|    ||.|||:|.          ....|:|...|  |:|..|..:|..|||:|||||:
Human     2 SDSEKLN----LDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPI 62

  Fly    67 LLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPE 131
            ||||.||:|||||:|||:.||||:|:..|.||.|||||||||||||..|:||:.|||.||::|||
Human    63 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPE 127

  Fly   132 TFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLN 196
            .|||||||||.|.:||:|||:|||||||:||||::|.||::|:|:|||:.::|||.||||||||.
Human   128 NFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ 192

  Fly   197 NLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVR 261
            :::.|||:.||||||..||||||||||||:....|..|||||||||||.:|..||.:|..:||.|
Human   193 SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICR 257

  Fly   262 AHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313
            |||||||||||||.|||||:|||||||..|||.||::.||..|:|.|.|::|
Human   258 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 190/307 (62%)
MPP_superfamily 25..313 CDD:301300 188/299 (63%)
PPP1CANP_001008709.1 PTZ00480 6..319 CDD:185658 190/308 (62%)
MPP_PP1_PPKL 8..309 CDD:277359 189/304 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.