DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and ppp5c

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001007891.1 Gene:ppp5c / 493275 XenbaseID:XB-GENE-982044 Length:493 Species:Xenopus tropicalis


Alignment Length:271 Identity:111/271 - (40%)
Similarity:159/271 - (58%) Gaps:10/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RELFLSQPMLLEL----SAPVKICGDLHGQFKDLLRIFQQCGVPPLSN-YLFLGDYVDRGHCSIE 117
            :::....|.|:|:    |..|.:|||.||||.||:.||...|:|..:| |:|.||:||||..|:|
 Frog   211 KDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVE 275

  Fly   118 TLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIAD 182
            .:..|..:||.||..|.|||||||:..:|::|||..|.|.:||.::::.|.:.:..:|:|..:..
 Frog   276 VIVTLFGFKLLYPAQFHLLRGNHETDTMNQMYGFEGEVKAKYSAQMFQLFSEVFQWLPLAMCVNQ 340

  Fly   183 RIFCVHGGL-SPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANI 246
            |:..:|||| |.|...||.||.:.|....|..|.:||||||||....|. :|:.||||..||.::
 Frog   341 RVLIMHGGLFSEDGVTLDQIRSIERNRQPPDSGPMCDLLWSDPQPQDGR-SSSKRGVSCQFGPDV 404

  Fly   247 VEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV---DAKLVCHF 308
            ...||.::..:.|:|:|:|..:|||...:...||:||||||||...|.||.:.:   |.|...|.
 Frog   405 TRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGSDLKPKFHQ 469

  Fly   309 VIIRPRPFSRP 319
            ....|.|..:|
 Frog   470 FEAVPHPNVKP 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 111/271 (41%)
MPP_superfamily 25..313 CDD:301300 108/263 (41%)
ppp5cNP_001007891.1 PLN03088 22..>232 CDD:330826 4/20 (20%)
TPR repeat 22..50 CDD:276809
TPR repeat 55..85 CDD:276809
TPR repeat 90..118 CDD:276809
MPP_PP5_C 170..485 CDD:277362 111/271 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.