DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and flw

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster


Alignment Length:332 Identity:190/332 - (57%)
Similarity:240/332 - (72%) Gaps:20/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEE--KNRMSQLDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVK 75
            :||  |:|:...|..:.:.    |.:.|.|   .::||.:..:|..|||:||.||:||||.||:.
  Fly   130 REEPKKSRLKLRDFFVAEF----VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLI 190

  Fly    76 ICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNH 140
            ||||:|||:.||||:|:..|.||.:||||||||||||..|:||:.|||.||::|||.||||||||
  Fly   191 ICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNH 255

  Fly   141 ESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLN 205
            |.|.:||:|||:|||||||::|||::|.||::|:||||||.::|||.||||||||..::.||||.
  Fly   256 ECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLM 320

  Fly   206 RPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGY 270
            ||||||..||||||||||||:....|..||||||||||.::|..||.:|:.:||.||||||||||
  Fly   321 RPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGY 385

  Fly   271 EFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRP-----------FSRPTGFES 324
            ||||.|||||:|||||||..|||.|.::.||..|:|.|.|::|..           .||||..:.
  Fly   386 EFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQR 450

  Fly   325 DSGSTAT 331
            .:...||
  Fly   451 SAPMLAT 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 188/327 (57%)
MPP_superfamily 25..313 CDD:301300 179/290 (62%)
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 178/278 (64%)
PP2Ac 160..430 CDD:197547 176/269 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438779
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.