DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Ppp1ccb

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001357876.1 Gene:Ppp1ccb / 434233 MGIID:3647492 Length:337 Species:Mus musculus


Alignment Length:332 Identity:194/332 - (58%)
Similarity:241/332 - (72%) Gaps:21/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.||.:|  :.|...:.|   .|.|..|..:|..|||:|||||:||||.||:|||||:|||:.|
Mouse     9 IDSIIQRL--LEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |||:|:..|.||.|||||||||||||..|:||:.|||.||::|||.|||||||||.|.:||:|||
Mouse    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   152 FDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLL 216
            :|||||||:||||::|.||::|:|:|||:.::|||.||||||||.:::.|||:.||||||..|||
Mouse   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   217 CDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTI 281
            |||||||||:....|..|||||||||||.:|..||.:|..:||.||||||||||||||.|||||:
Mouse   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   282 FSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRPFSRPTGFESDSGSTATATNGPP-------PS 339
            |||||||..|||.||::.||..|:|.|.|::|....:|         .||....||       ||
Mouse   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKP---------NATRPVTPPRVGSGLNPS 322

  Fly   340 MREKRLY 346
            :::...|
Mouse   323 IQKASNY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 191/323 (59%)
MPP_superfamily 25..313 CDD:301300 185/290 (64%)
Ppp1ccbNP_001357876.1 MPP_PP1_PPKL 8..298 CDD:277359 185/290 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.