DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and rdgC

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:308 Identity:104/308 - (33%)
Similarity:167/308 - (54%) Gaps:21/308 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RMSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFK 85
            |.:.:|::|...:... |||.........:....::.::|....|:...:|..|.:||||||:..
  Fly   186 RKNHIDLLIDVFRKKR-GNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLD 249

  Fly    86 DLLRIFQQCGVPPLSN-YLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVY 149
            |||.:..:.|:|..|| |:|.||:||||...:|.|.|||:..|.:|...||.|||||.:.:|..|
  Fly   250 DLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARY 314

  Fly   150 GFFDECKRRY--SIKLWRSFVD-CYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNR----- 206
            ||..|.:.:|  :.|...:|:| .|..:|:.:::..|:..||||.| |..:||.|:.::|     
  Fly   315 GFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVS 378

  Fly   207 ----------PTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVR 261
                      |.|......:.|::||||..|.|...:..||....||.::.:.||.:|:.:.::|
  Fly   379 ILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIR 443

  Fly   262 AHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFV 309
            :|:...:|:||..|.:::|||||.||..|..|.||.:.::.:|:.|||
  Fly   444 SHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 104/308 (34%)
MPP_superfamily 25..313 CDD:301300 103/304 (34%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 104/308 (34%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3051
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.