DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and ppp4c

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_988943.1 Gene:ppp4c / 394540 XenbaseID:XB-GENE-970535 Length:307 Species:Xenopus tropicalis


Alignment Length:295 Identity:129/295 - (43%)
Similarity:191/295 - (64%) Gaps:9/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.||..|.||       ||...:.|:.:..:|..:||:.:.:..:..:.:||.:|||:||||.|
 Frog     4 ISDLDRQIEQL-------RRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYD 61

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |..:|:..|..|.:||||:||:||||..|:||..|||..|:|||:...|:||||||..:.:||||
 Frog    62 LKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGF 126

  Fly   152 FDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGL 215
            :|||.|:| |:.:||...:.:|.:.::|||..:||||||||||.:..||.||.::|..:||.||.
 Frog   127 YDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGP 191

  Fly   216 LCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVT 280
            :||||||||::||| |..:.||..:.||:::|..|...:..::|.||||:|.:||::..:..::|
 Frog   192 MCDLLWSDPEDTTG-WGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNETVLT 255

  Fly   281 IFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRP 315
            ::||||||....|..|:|.:|..|...|:|....|
 Frog   256 VWSAPNYCYRCGNVAAILELDEHLQKEFIIFEAAP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 129/295 (44%)
MPP_superfamily 25..313 CDD:301300 127/288 (44%)
ppp4cNP_988943.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 127/291 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.