DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and ppp2cab

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_957205.2 Gene:ppp2cab / 393885 ZFINID:ZDB-GENE-040426-877 Length:309 Species:Danio rerio


Alignment Length:300 Identity:135/300 - (45%)
Similarity:192/300 - (64%) Gaps:9/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEKNRMSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLH 81
            |||....:||..|.||       .....|||..:..:|:.::|:...:..:.|:..||.:|||:|
Zfish     2 EEKAFAKELDQWIEQL-------NECKQLSETQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVH 59

  Fly    82 GQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLN 146
            |||.||:.:|:..|..|.:||||:|||||||:.|:||:|||:..|:||.|...:|||||||..:.
Zfish    60 GQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRERVTILRGNHESRQIT 124

  Fly   147 RVYGFFDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDV 210
            :||||:|||.|:| :..:|:.|.|.:|.:|:.|::..:|||:||||||.::.||.||.|:|..:|
Zfish   125 QVYGFYDECLRKYGNANVWKFFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEV 189

  Fly   211 PSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFAD 275
            |.:|.:|||||||||: .|.|..:.||..:|||.:|.|.|...:...|:.||||:|.:||.:..|
Zfish   190 PHEGPMCDLLWSDPDD-RGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHD 253

  Fly   276 RQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRP 315
            |.:||||||||||....|..|::.:|..|...|:...|.|
Zfish   254 RNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 132/297 (44%)
MPP_superfamily 25..313 CDD:301300 130/288 (45%)
ppp2cabNP_957205.2 MPP_PP2A_PP4_PP6 9..293 CDD:277360 131/291 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.