DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and ppp1cbl

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_956210.1 Gene:ppp1cbl / 334597 ZFINID:ZDB-GENE-030131-6529 Length:281 Species:Danio rerio


Alignment Length:338 Identity:162/338 - (47%)
Similarity:205/338 - (60%) Gaps:81/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QLDV--IIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQ 83
            :|||  :|.:|  :.|...|.|   .::||.:..:|..|||:|||||:||||             
Zfish     5 ELDVDSLISRL--LEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLEL------------- 54

  Fly    84 FKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRV 148
                                             ||:.|||.||::|||.|||||||||.|.:||:
Zfish    55 ---------------------------------ETICLLLAYKIKYPENFFLLRGNHECASINRI 86

  Fly   149 YGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSD 213
            |||:||||||::||||::|.||::|:|:|||:.::|||.||||||||.:::.|||:.||||||..
Zfish    87 YGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDT 151

  Fly   214 GLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQL 278
            ||||||||||||:....|..|||||||||||::|..||.:|..:||.||||||||||||||.|||
Zfish   152 GLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 216

  Fly   279 VTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP---------------RPFSRPTGFESDSGS 328
            ||:|||||||..|||.|.::.||..|:|.|.|::|               ||.:.|         
Zfish   217 VTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPP--------- 272

  Fly   329 TATATNGPPPSMR 341
             .|||   ||..|
Zfish   273 -RTAT---PPKKR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 160/334 (48%)
MPP_superfamily 25..313 CDD:301300 152/292 (52%)
ppp1cblNP_956210.1 PTZ00480 3..254 CDD:185658 153/296 (52%)
MPP_superfamily 7..251 CDD:301300 151/291 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.