DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and sds21

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001342764.1 Gene:sds21 / 2539179 PomBaseID:SPCC31H12.05c Length:322 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:189/311 - (60%)
Similarity:237/311 - (76%) Gaps:2/311 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGN-RRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLL 88
            :|.||.:|.....|. .:...||:|.|.|:|..||.:||||||||||.||:|||||:|||:.|||
pombe     5 IDAIIEKLVKARNGKPSKQVQLSDAEIRYLCTTSRSIFLSQPMLLELEAPLKICGDIHGQYSDLL 69

  Fly    89 RIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFD 153
            |:|:..|.||.:||||||||||||..|:|.:.||..||::|||.|||||||||.|.:||:|||:|
pombe    70 RLFEYGGYPPDANYLFLGDYVDRGKQSLEVICLLFAYKIKYPENFFLLRGNHEFASINRIYGFYD 134

  Fly   154 ECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCD 218
            |||||||||||::|.||::||||||:|.::|||:|||||||||:||.|:|:.||||:|..|||||
pombe   135 ECKRRYSIKLWKTFTDCFNCMPVAAVIDEKIFCMHGGLSPDLNSLDQIQRIIRPTDIPDTGLLCD 199

  Fly   219 LLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFS 283
            |:||||::....|..||||||:||||::|..||.:|..:||.|||||||||||||..||||||||
pombe   200 LVWSDPEKDLTGWGENDRGVSYTFGADVVSRFLQKHDLDLICRAHQVVEDGYEFFGKRQLVTIFS 264

  Fly   284 APNYCDIFDNCGAVLVVDAKLVCHFVIIRPRPFSRPTGFESDSGSTATATN 334
            |||||..|||.||::.|:..|:|.|.|::|.. .|....:|....:.:|||
pombe   265 APNYCGEFDNVGAMMSVNEDLLCSFQILKPAE-KRQRVSQSSIKESKSATN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 189/311 (61%)
MPP_superfamily 25..313 CDD:301300 183/288 (64%)
sds21NP_001342764.1 MPP_PP1_PPKL 4..294 CDD:277359 183/288 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.