DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Ppp2ca

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_058735.1 Gene:Ppp2ca / 24672 RGDID:3380 Length:309 Species:Rattus norvegicus


Alignment Length:300 Identity:133/300 - (44%)
Similarity:193/300 - (64%) Gaps:9/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEKNRMSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLH 81
            :||....:||..|.||       .....|||:.:..:|:.::|:...:..:.|:..||.:|||:|
  Rat     2 DEKLFTKELDQWIEQL-------NECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVH 59

  Fly    82 GQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLN 146
            |||.||:.:|:..|..|.:||||:|||||||:.|:||::||:..|:||.|...:|||||||..:.
  Rat    60 GQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQIT 124

  Fly   147 RVYGFFDECKRRY-SIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDV 210
            :||||:|||.|:| :..:|:.|.|.:|.:|:.|::..:|||:||||||.::.||.||.|:|..:|
  Rat   125 QVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEV 189

  Fly   211 PSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFAD 275
            |.:|.:|||||||||: .|.|..:.||..:|||.:|.|.|...:...|:.||||:|.:||.:..|
  Rat   190 PHEGPMCDLLWSDPDD-RGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHD 253

  Fly   276 RQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRP 315
            |.:||||||||||....|..|::.:|..|...|:...|.|
  Rat   254 RNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 131/297 (44%)
MPP_superfamily 25..313 CDD:301300 129/288 (45%)
Ppp2caNP_058735.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 130/291 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.