DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Ppp1cc

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:332 Identity:194/332 - (58%)
Similarity:241/332 - (72%) Gaps:21/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.||.:|  :.|...:.|   .|.|..|..:|..|||:|||||:||||.||:|||||:|||:.|
  Rat     9 IDSIIQRL--LEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |||:|:..|.||.|||||||||||||..|:||:.|||.||::|||.|||||||||.|.:||:|||
  Rat    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   152 FDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLL 216
            :|||||||:||||::|.||::|:|:|||:.::|||.||||||||.:::.|||:.||||||..|||
  Rat   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   217 CDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTI 281
            |||||||||:....|..|||||||||||.:|..||.:|..:||.||||||||||||||.|||||:
  Rat   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   282 FSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRPFSRPTGFESDSGSTATATNGPP-------PS 339
            |||||||..|||.||::.||..|:|.|.|::|....:|         .||....||       ||
  Rat   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKP---------NATRPVTPPRVGSGLNPS 322

  Fly   340 MREKRLY 346
            :::...|
  Rat   323 IQKASNY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 191/323 (59%)
MPP_superfamily 25..313 CDD:301300 185/290 (64%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 185/290 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.