DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Ppef1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_011246120.1 Gene:Ppef1 / 237178 MGIID:1097157 Length:676 Species:Mus musculus


Alignment Length:358 Identity:108/358 - (30%)
Similarity:171/358 - (47%) Gaps:73/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 STGKESSKEEKNRMSQLDVIIGQLKTMAVGNRRAGNLSEATITYICQASRE------------LF 61
            :|.:||  :.|:|...|.:|  ::.....|.|....|:...|..:.||.::            ||
Mouse   113 NTRRES--QIKDRDDFLGLI--EVPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLF 173

  Fly    62 LSQPMLLEL-------SAPVK---ICGDLHGQFKDLLRIFQQCGVPPLSN-YLFLGDYVDRGHCS 115
            .::.:|.::       :.|.|   |||||||:..||:.||.:.|:|..:| |:|.||:||||:.|
Mouse   174 EARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNS 238

  Fly   116 IETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSI---KLWRSFVDCYDCMPVA 177
            :|.|.:||...|.||....|.|||||...:|..|||..|..::|.:   |:.:...:.|..:|:.
Mouse   239 MEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIG 303

  Fly   178 AIIADRIFCVHGGL--SPDLNNLDDIRRLNR---------------------------------P 207
            .||.:.|..:|||:  |.|||.|..::| |:                                 |
Mouse   304 TIIDNEILVIHGGISESTDLNTLHQLQR-NKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEP 367

  Fly   208 TDVPSDGL-------LCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQV 265
            ...||:.|       :.|:|||||....|.:.:..||....||.::....|.:::..:::|:|:.
Mouse   368 DKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHEC 432

  Fly   266 VEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVL 298
            ..||||...|.:::|:|||.||.:...|.||.:
Mouse   433 KPDGYEVSHDGKVITVFSASNYYEEGSNRGAYI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 105/348 (30%)
MPP_superfamily 25..313 CDD:301300 103/342 (30%)
Ppef1XP_011246120.1 MPP_RdgC 144..479 CDD:277364 99/323 (31%)
PTZ00183 518..660 CDD:185503
EF-hand_7 595..663 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831305
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3051
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.690

Return to query results.
Submit another query.