DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and Y40H4A.2

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_506609.2 Gene:Y40H4A.2 / 189799 WormBaseID:WBGene00012741 Length:333 Species:Caenorhabditis elegans


Alignment Length:317 Identity:126/317 - (39%)
Similarity:190/317 - (59%) Gaps:18/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESSKEEKNRMSQLDVIIGQLKTMAVGNRRAG----NLSEATITYICQASRELFLSQPMLLELS-- 71
            |.|:.::.|::.|...|.:|.|..:..:...    .:|:..|..|...:...|.|...|:.:.  
 Worm    12 EDSENDQERVAYLKAFISRLMTAPMKEKSPAEVDVTVSKEEIRIISNYAAASFGSFSTLMRVDED 76

  Fly    72 -APVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFL 135
             .||.|.|||||.|.||.|||...|.|.:|:|:|||||||||...|||:.||:.|...||:..||
 Worm    77 CLPVHIVGDLHGHFGDLRRIFGIHGAPGISHYVFLGDYVDRGRQGIETVMLLMAYHCLYPDHLFL 141

  Fly   136 LRGNHESADLNRVYGFFDECKRRYSIK---LWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNN 197
            .|||||..:....|||||||:.:|..|   .|...::.::.:|:||:|.|::.|:|||:||.:..
 Worm   142 CRGNHEDYNTTMTYGFFDECRMKYGKKGTLAWLHIINAFNHLPLAALILDKVLCMHGGISPHIQK 206

  Fly   198 LDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGT-WASNDRGVSFTFGANIVEGFLMQHKFNLIVR 261
            |:||.::.|||.:||.||.|||:||||::|:.. |:.:.||:||:|....:|.|...:..:||||
 Worm   207 LEDIDKIQRPTFIPSYGLACDLVWSDPEKTSNVGWSLSARGISFSFDDITIEKFCQDNGLDLIVR 271

  Fly   262 AHQV----VEDGYEFFADRQLVTIFSAPNYCDI-FDNCGAVLVVDAKLVCHFVIIRP 313
            |||:    :..|:::.|:.::||||||.||..: .|:|  |:.:|.:....|.::||
 Worm   272 AHQISSEMIRGGHKWHANGRMVTIFSAANYLSMGNDSC--VIRIDEQKTMQFCLLRP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 124/311 (40%)
MPP_superfamily 25..313 CDD:301300 121/303 (40%)
Y40H4A.2NP_506609.2 PP2Ac 49..328 CDD:197547 119/280 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.