DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and R08A2.2

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_506632.2 Gene:R08A2.2 / 187692 WormBaseID:WBGene00011133 Length:371 Species:Caenorhabditis elegans


Alignment Length:264 Identity:107/264 - (40%)
Similarity:161/264 - (60%) Gaps:6/264 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRY 129
            |.:|::..|:.|.||:|||...|:|.|...|.||...:||||||||||..|.|...||..||:||
 Worm    56 PAMLQVEHPITIVGDIHGQLDALIRYFDAVGYPPKVKFLFLGDYVDRGAKSFEVSLLLFCYKIRY 120

  Fly   130 PETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPD 194
            |.:..|||||||...:||:|||::|..|:...::||.:.:.::.:|:.|.:..||.|:|||:|.:
 Worm   121 PHSVHLLRGNHECMKMNRLYGFYEELARKRGGRMWRQYQNVFNELPLCARVGQRILCMHGGISQN 185

  Fly   195 LNNLDDIRRLNRPTDVP---SDGLLCDLLWSDP-DETTGTWASN-DRGVSFTFGANIVEGFLMQH 254
            .|:.:..:.|.:| :.|   .:||..||:|:|| .:...|:|.| .|.:|..||...::.||.:.
 Worm   186 CNSWESFKALKKP-NTPLTCDEGLQVDLMWADPTQDKCNTFAMNKQRAISVVFGEKGLDVFLKKL 249

  Fly   255 KFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRPFSRP 319
            ..:||||||:|.::|:.|..:::.||:||||.||....||||::.|.......|.::|||..:.|
 Worm   250 GLSLIVRAHEVSQEGFNFLFNKKCVTVFSAPYYCGNDTNCGAIMHVSESYEISFTVLRPRMIATP 314

  Fly   320 TGFE 323
            ...|
 Worm   315 ENIE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 107/264 (41%)
MPP_superfamily 25..313 CDD:301300 102/252 (40%)
R08A2.2NP_506632.2 PP2Ac 36..308 CDD:197547 102/252 (40%)
MPP_PPP_family 66..295 CDD:277316 97/229 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.