DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and F44B9.9

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:253 Identity:78/253 - (30%)
Similarity:117/253 - (46%) Gaps:74/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ELFLSQPMLLELSAPVKICGDLHGQFKDLLRIF------QQCGVPPL-----SNYLFLGDYVDRG 112
            |||..:..|.|:|.||.|.||:||||:||:|:.      :.....|:     ..::|||||||||
 Worm    18 ELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFSTKKWVFLGDYVDRG 82

  Fly   113 HCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVA 177
            :.|::.:.|:.:.|:.:|:.:.|||||||:..:|..|||                       .|.
 Worm    83 YKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF-----------------------RVC 124

  Fly   178 AIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTF 242
            :::..:|..                   :|:.:                     .:|.||:|..|
 Worm   125 SVVVLKIPA-------------------KPSFI---------------------RNNKRGLSVCF 149

  Fly   243 GANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV 300
            ....|.........:||||.||::..|::|||||:|.||||||.|.:..||.|||:.|
 Worm   150 NEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDNSGAVMKV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 78/253 (31%)
MPP_superfamily 25..313 CDD:301300 78/253 (31%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.