DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and F23B12.1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_506574.3 Gene:F23B12.1 / 184887 WormBaseID:WBGene00009079 Length:329 Species:Caenorhabditis elegans


Alignment Length:298 Identity:147/298 - (49%)
Similarity:204/298 - (68%) Gaps:4/298 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EKNRMSQ-LDVIIGQLKTMAVGNRRAGNL-SEATITYICQASRELFLSQPMLLELSAPVKICGDL 80
            :||::.. |..:|.:||..:.|  |...| .|..:..:|..:||.|....:.|::.||||||||:
 Worm    22 QKNKVQNWLHSVIERLKWWSPG--RCQQLFVENELIELCYRAREQFWKNKVKLDIEAPVKICGDI 84

  Fly    81 HGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADL 145
            ||||:||:.:|:..|.|....|||||||||||..|||.::||.|:::..|:..|||||||||..:
 Worm    85 HGQFEDLMALFELNGWPEEHKYLFLGDYVDRGPFSIEVITLLFTFQILMPDKVFLLRGNHESRPV 149

  Fly   146 NRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDV 210
            |..|||:.|||:|||:.|:.:|...::|||:.|:::.:|.|:|||:|.||.:|..:.:::||.|:
 Worm   150 NMQYGFYLECKKRYSVALYDAFQLAFNCMPLCAVVSKKIICMHGGISEDLIDLTQLEKIDRPFDI 214

  Fly   211 PSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFAD 275
            |..|::.||.|:||||....:|.:.||...:||.|.|:.||..|..:|:|||||||.||||||||
 Worm   215 PDIGVISDLTWADPDEKVFGYADSPRGAGRSFGPNAVKKFLQMHNLDLVVRAHQVVMDGYEFFAD 279

  Fly   276 RQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313
            |||||:||||:||..|||..||:.||.||:|.|.|.||
 Worm   280 RQLVTVFSAPSYCGQFDNAAAVMNVDDKLLCTFTIFRP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 147/297 (49%)
MPP_superfamily 25..313 CDD:301300 143/288 (50%)
F23B12.1NP_506574.3 PP2Ac 51..317 CDD:197547 136/265 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.