DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and gsp-1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001256250.1 Gene:gsp-1 / 179486 WormBaseID:WBGene00001747 Length:329 Species:Caenorhabditis elegans


Alignment Length:323 Identity:190/323 - (58%)
Similarity:240/323 - (74%) Gaps:6/323 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86
            :|.:|.:|  :.|...|.|   .:|||.|..:|..|||:|||||:||||.||:|||||:|||:.|
 Worm     9 IDNLITRL--LEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYND 71

  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151
            |||:|:..|.||.:||||||||||||..|:||:.|||.||::|||.|||||||||.|.:||:|||
 Worm    72 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGF 136

  Fly   152 FDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLL 216
            :||||||:|||||::|.||::|:|:||:|.::|||.||||||||.|::.|||:.||||||..|||
 Worm   137 YDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDVPDTGLL 201

  Fly   217 CDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTI 281
            |||||||||:....|..||||||||||.::|..||.:|..:||.||||||||||||||.|||||:
 Worm   202 CDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   282 FSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRPRPFSRPTGFES-DSGSTATATNGPPPSMREK 343
            |||||||..|||.|.::.||..|:|.|.|::|........::. :||..|.....|..:..:|
 Worm   267 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYQGMNSGRPAVGGGRPGTTAGKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 189/317 (60%)
MPP_superfamily 25..313 CDD:301300 184/290 (63%)
gsp-1NP_001256250.1 MPP_PP1_PPKL 8..298 CDD:277359 184/290 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.