DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and C25A6.1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_504432.3 Gene:C25A6.1 / 178923 WormBaseID:WBGene00016081 Length:300 Species:Caenorhabditis elegans


Alignment Length:273 Identity:130/273 - (47%)
Similarity:181/273 - (66%) Gaps:21/273 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYV 109
            ::|..:..:...:.::|..|..::|::||:|:|||:||||.||||:|.:.|.||.:|||||||||
 Worm    27 ITEGRVLKLLDLALDVFKRQKSMVEMNAPIKVCGDIHGQFPDLLRLFHRGGWPPTANYLFLGDYV 91

  Fly   110 DRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRY-SIKLWRSFVDCYDC 173
            |||..||||:.|||.||:::|...||||||||...:|:||||::||::|| |::::.:|.|.::.
 Worm    92 DRGRFSIETIVLLLAYKVKFPGNLFLLRGNHECEFVNKVYGFYEECQKRYQSVRMFTAFQDVFNW 156

  Fly   174 MPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDG---LLCDLLWSDPDETTGTWASND 235
            :|:..:||::|.|:||||||.                 .||   |:.||||:||......:..|:
 Worm   157 LPLCGLIANKILCMHGGLSPS-----------------HDGKERLVADLLWADPISGLSGFMENN 204

  Fly   236 RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV 300
            ||....||.:.|.......|.:||.||||||:|||||||.|:||||||||:||..||||.|.:..
 Worm   205 RGAGCGFGRDAVLKVCSDFKLDLICRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSC 269

  Fly   301 DAKLVCHFVIIRP 313
            |.||.|.|.|:||
 Worm   270 DEKLQCSFEILRP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 130/273 (48%)
MPP_superfamily 25..313 CDD:301300 128/271 (47%)
C25A6.1NP_504432.3 MPP_superfamily 5..282 CDD:301300 128/271 (47%)
PP2Ac 32..284 CDD:197547 129/268 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.