DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and C47A4.3

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_502650.1 Gene:C47A4.3 / 178340 WormBaseID:WBGene00008124 Length:316 Species:Caenorhabditis elegans


Alignment Length:273 Identity:133/273 - (48%)
Similarity:192/273 - (70%) Gaps:5/273 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYV 109
            ::|..:..:...:..:|.:|..::|::||:|:|||:||||.||||:|.:.|.||.:|||||||||
 Worm    27 ITEERVLKLLDLALGVFKAQKPMVEVNAPIKVCGDIHGQFPDLLRLFHRGGWPPTANYLFLGDYV 91

  Fly   110 DRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRY-SIKLWRSFVDCYDC 173
            |||..||||:.|||.||:::|..|||||||||...:|:.|||::||::|| |::::.:|.|.::.
 Worm    92 DRGRFSIETIVLLLAYKVKFPCNFFLLRGNHECEFVNKTYGFYEECQKRYQSVRMYAAFQDVFNW 156

  Fly   174 MPVAAIIADRIFCVHGGLSPDLN---NLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASND 235
            :|:..:||.:|.|:||||||.:.   .||.:|::.|||: ..:||:.||||:||......:.:|.
 Worm   157 LPLTGLIATKILCMHGGLSPLMTKEFTLDTLRKIERPTE-GKEGLVADLLWADPISGLSGFMNNQ 220

  Fly   236 RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV 300
            ||....||.:.|.....:.:.:|:.||||||:|||||||.|:||||||||:||..||||.|.:..
 Worm   221 RGAGCGFGRDSVLNLCSEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSC 285

  Fly   301 DAKLVCHFVIIRP 313
            |.||.|.|.|:||
 Worm   286 DEKLQCSFEILRP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 133/273 (49%)
MPP_superfamily 25..313 CDD:301300 131/271 (48%)
C47A4.3NP_502650.1 MPP_superfamily 5..298 CDD:301300 131/271 (48%)
PP2Ac 27..299 CDD:197547 133/273 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.