DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and tax-6

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001367052.1 Gene:tax-6 / 177943 WormBaseID:WBGene00006527 Length:545 Species:Caenorhabditis elegans


Alignment Length:298 Identity:115/298 - (38%)
Similarity:173/298 - (58%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RAGNLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFL 105
            :.|.:.|.....:.|....||.::..:||:.|||.:|||:||||.||:::|:..|.|..:.||||
 Worm    77 KEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSPATTKYLFL 141

  Fly   106 GDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDC 170
            |||||||:.|||.:..|...|:.||.|.||||||||...|...:.|..|||.:||.:::...::.
 Worm   142 GDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMES 206

  Fly   171 YDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASND 235
            :|.:|:||::..:..||||||||:::.|:||||::|..:.|:.|.:||||||||.|..|...:::
 Worm   207 FDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSE 271

  Fly   236 -------RGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQ------LVTIFSAPNY 287
                   ||.|:.:.......||..:....|:|||:..:.||..:...|      |:||||||||
 Worm   272 QFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNY 336

  Fly   288 CDIFDNCGAVLVVDAKLV------CHFVIIRPRPFSRP 319
            .|:::|..|:|..:..::      |     .|.|:..|
 Worm   337 LDVYNNKAAILKYENNVMNIRQFNC-----SPHPYWLP 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 115/298 (39%)
MPP_superfamily 25..313 CDD:301300 112/290 (39%)
tax-6NP_001367052.1 MPP_PP2B 66..370 CDD:277361 115/298 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.