DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and pph-4.2

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001022898.1 Gene:pph-4.2 / 176663 WormBaseID:WBGene00004086 Length:321 Species:Caenorhabditis elegans


Alignment Length:257 Identity:118/257 - (45%)
Similarity:169/257 - (65%) Gaps:1/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYV 109
            :.|..:..||...||:.:.:..:..:..||.||||:||||.||:.:|:..|.||.:|||||||||
 Worm    30 ICETQVKSICAKVREILIEEANVQVIDTPVTICGDIHGQFHDLMELFRVGGSPPNTNYLFLGDYV 94

  Fly   110 DRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRY-SIKLWRSFVDCYDC 173
            |||:.|:||..||:..|.|||:...|:||||||..:.:||||:|||.|:| |.::|:...:.:|.
 Worm    95 DRGYNSVETFILLMLLKCRYPDRITLIRGNHESRQITQVYGFYDECVRKYGSGQVWKHCTEIFDY 159

  Fly   174 MPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGV 238
            :.:||:|..::|||||||||.:..||.||.|:|..:||.:|.:||||||||:|....|..:.||.
 Worm   160 LSLAAVIDGKLFCVHGGLSPSIATLDQIRVLDRKIEVPHEGPMCDLLWSDPEEGCSGWGISPRGA 224

  Fly   239 SFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV 300
            .:.||.:..|.|...:.|..|.||||:|.:||:....:::||::||||||....|..|::.|
 Worm   225 GYLFGGDAAELFCENNDFLRICRAHQLVMEGYKLHFRKRVVTVWSAPNYCYRCGNVAAIMEV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 118/257 (46%)
MPP_superfamily 25..313 CDD:301300 118/257 (46%)
pph-4.2NP_001022898.1 PTZ00239 16..321 CDD:173488 118/257 (46%)
MPP_PP2A_PP4_PP6 16..303 CDD:277360 118/257 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.