DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and C23G10.1

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001367544.1 Gene:C23G10.1 / 175880 WormBaseID:WBGene00016010 Length:454 Species:Caenorhabditis elegans


Alignment Length:306 Identity:135/306 - (44%)
Similarity:184/306 - (60%) Gaps:13/306 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESSKEEKNRMSQLDVIIGQLKTMAV--GNRRAGNLSEATITYICQASRELFLSQPMLLELSAPVK 75
            :...:|.|:|.....|    ||:..  |..:...:....:.:||   :::|..|..::|:..||:
 Worm   135 QKQSDESNKMFAEHFI----KTLLACKGMTKIRTMDIFRLIHIC---KKIFTVQKSMVEIDGPVR 192

  Fly    76 ICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNH 140
            ||||||||:.||:|:|.|.|.||.|||||||||||||..::|.:.|.|.||.|||..|.:|||||
 Worm   193 ICGDLHGQYPDLIRLFAQGGFPPDSNYLFLGDYVDRGSFNLEVILLCLAYKARYPNNFMMLRGNH 257

  Fly   141 ESADLNRVYGFFDEC---KRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIR 202
            |...:|..|||.||.   |..|..:|:..|.:..|.||:.|::..||.|:|||||..:.:|||:|
 Worm   258 EVIHINEKYGFKDEVFNRKGEYHDELYPEFNEMMDMMPLVALVGGRILCMHGGLSQHIKSLDDLR 322

  Fly   203 RLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVE 267
            .|.||.....:.|..|::||||.:.:| |.:|.||.|..||.|.|:........:||||.||||:
 Worm   323 NLRRPFHSEDECLENDIMWSDPAKVSG-WTANPRGASVQFGENEVKEMCKLLDIDLIVRGHQVVQ 386

  Fly   268 DGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313
            |||||||.::|||:||||:|...|.|..||..|.|.|...|.:::|
 Worm   387 DGYEFFAGKKLVTVFSAPHYMQSFTNSAAVCKVSAGLEVSFEVLKP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 134/300 (45%)
MPP_superfamily 25..313 CDD:301300 131/292 (45%)
C23G10.1NP_001367544.1 PP2Ac 162..432 CDD:197547 127/273 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104510
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.