DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD5 and F58G1.3

DIOPT Version :9

Sequence 1:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_496754.2 Gene:F58G1.3 / 174933 WormBaseID:WBGene00010265 Length:364 Species:Caenorhabditis elegans


Alignment Length:356 Identity:138/356 - (38%)
Similarity:199/356 - (55%) Gaps:36/356 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STVLSTGKESSKE--EKNRMSQLDVIIGQLKTMAVGN-----------RRAGNLSEATITYICQA 56
            ||..:..|:.|||  :.:.:|:.|        :|..|           :|..:|.:.|...||..
 Worm     2 STDGNNNKKGSKEGPKTSEISKFD--------LAKENPRLAEWMDDCIKRMNSLYKDTNINICNV 58

  Fly    57 S------------RELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYV 109
            .            ..:|:.:..|.|..||:|:.||:|.||:|:.|:|...|..|....:||||||
 Worm    59 MTGHEIIAIIRMVEAIFMDESNLCEAEAPIKVIGDIHAQFQDMNRLFDLIGRVPEEKLMFLGDYV 123

  Fly   110 DRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCM 174
            |||...||.|.||...|:||.:..:|||||||:..:|::|||:.||:.:|.:.||..|..|::.|
 Worm   124 DRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFYVECQYKYGVGLWWDFQTCFNRM 188

  Fly   175 PVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVS 239
            |::.:|:.|:.|:||||||:|.|||.||.:.||.:....|||.|||||||......|..:.||:|
 Worm   189 PMSGLISKRVLCMHGGLSPELINLDTIRNIPRPCEPLDRGLLIDLLWSDPTNKGEGWFHSIRGIS 253

  Fly   240 FTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKL 304
            :.||..:||......:.:||:|.||||:||||..|.|:|:|:||.||||..|.|..||:.::|.|
 Worm   254 YMFGKGVVEQACKSLEIDLIIRGHQVVQDGYEMMAGRRLITVFSVPNYCAQFTNAAAVVCLNANL 318

  Fly   305 VCHFVIIRPRPFSRPTGFESDSG-STATATN 334
            ...|..:.|.|.  |.|.::.:. :.|..||
 Worm   319 QVSFQQLIPPPL--PDGTKAKAAPAIAIDTN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 132/340 (39%)
MPP_superfamily 25..313 CDD:301300 124/310 (40%)
F58G1.3NP_496754.2 MPP_superfamily 37..327 CDD:301300 121/289 (42%)
PP2Ac 59..329 CDD:197547 117/269 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.